PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010906631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family HB-PHD
Protein Properties Length: 855aa    MW: 95749.5 Da    PI: 5.8068
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010906631.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox451.8e-14713764556
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++f +  ++ L + F++n+yps+e++e+LA +lg+t rq+  WF N R  ++
  XP_010906631.1 713 RRFDPVVTQKLHDSFKENQYPSRETKERLAIELGMTSRQIGKWFENARHSMR 764
                     57899999****************************************8876 PP

2PHD40.85.2e-14313368151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C++     +++++lCdg C++ fH+kCl+++l se++p+g   wlC+ C++k
  XP_010906631.1 313 FCAKCSSkdLSVDNDIILCDGaCDRGFHQKCLDPPLLSENIPSGdeGWLCPACDCK 368
                     6999*9955445********66*********************9*9*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579035.76E-14303371IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.2E-12307368IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.119311368IPR019787Zinc finger, PHD-finger
SMARTSM002494.9E-10313366IPR001965Zinc finger, PHD-type
PfamPF006282.1E-11313368IPR019787Zinc finger, PHD-finger
CDDcd155044.75E-29313365No hitNo description
PROSITE patternPS013590314365IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.847706766IPR001356Homeobox domain
SMARTSM003896.4E-13709770IPR001356Homeobox domain
CDDcd000864.78E-13712764No hitNo description
SuperFamilySSF466898.13E-13712771IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-14714771IPR009057Homeodomain-like
PfamPF000468.0E-12714764IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 855 aa     Download sequence    Send to blast
MLYHMNGLIT SEKRSLFQKS LRMSFSCSCP RHAPAIIYFS SSAPFSHLYA GIENIFVHLH  60
RKFAGGITLF RDGISLAVML WALLVTATYL DFFLHQEQGL KSEGIENDST EVGRADSNHV  120
DSDKLTTLAE HDKSIKPNSQ KADMKHGAKK NSKRTLQKGK KASQSLRGKR YFLRSSLDGV  180
RVLRSMSKGK SKTPAESVTP PVNPTTKRRK RRGKVKGASK DEFSLTRKRV RYLLTRINYE  240
QSLIDAYSSE GWKGQSLEKL RPEKELERAK SEILRCKLKI RDSFRCLDSL LSAGRLQESL  300
FDSDGQICSE DIFCAKCSSK DLSVDNDIIL CDGACDRGFH QKCLDPPLLS ENIPSGDEGW  360
LCPACDCKVD CIDLLSEFQG SSDLSIEDSW EKVFPEAAAI ANSDKQYDLS NLPSDDSEDD  420
NYDPDVLEVD TEDHMEESSS EEDHEEQSSS EESYFTYSSE DSGPSEKRKH YEDIGLSSDD  480
SEDDDYDPEG PDPDKEIQKE SSGSDESDFT SDSDDFCAEL SKSGGTDEVS ASSLPNLKPL  540
EPSGEGERVS DRNENATNSE QPSMLEPDPS QKNALPVSGK RQRDRLDYKK LYDETYGKAS  600
SDSSDDEDWS DKNALKKGKK DDHVEETDVL KARSKSTENY RSSGRAKRKA TVENIVTKSD  660
LVQKQVLLAT SEDTPKKAYQ QKLQSASLHH TQKHDDPWEP DSNGDGATTS VQRRFDPVVT  720
QKLHDSFKEN QYPSRETKER LAIELGMTSR QIGKWFENAR HSMRVSAKEA NHAVVSTPEE  780
GTSSTKAKGN NDKPDKGGVR NYASNGSKGK KSVGERNDEV GAGRDTSSGE KRKDTQENNR  840
KKAIERELRK RRKSR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1830852KRKDTQENNRKKAIERELRKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010906631.10.0PREDICTED: homeobox protein HOX1A isoform X1
TrEMBLK3Z4970.0K3Z497_SETIT; Uncharacterized protein
STRINGSi021365m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-73Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain